DPCstruct | MC50999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 134 ± 27 aa |
| Standard deviation of domain lengths | 27.16 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03918 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7PA37 | 9-130 | PLLAWAAPPPGSVNEDTVHQIAAQLRCVVCQNLSVADSPSEMANQMRGIIRERLQAGDTHEQVVAYFVDKYGEWILLSPRPRGFNLL… |
| A0A847J7B2 | 4-103 | DPKLEARAREISGELRCLVCQNQSIDDSDAPLAKDLRILVRERLKAGDDDGQVKDWLVARYGEFVLLRPRFETQTLILWLAPFVVLG… |
| A0A5N9GJG4 | 11-155 | None |
| A0A813A102 | 108-247 | None |
| A0A7V9LBC8 | 70-273 | None |
| A0A220VEW6 | 23-158 | None |
| A0A521GU77 | 9-123 | None |
| A0A1I1FQK3 | 3-148 | None |
| A0A7Y3LBS7 | 41-171 | None |
| A0A7K0WMM8 | 15-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.