DPCstruct | MC50996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 3.89 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 49.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0567 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F5FUF7 | 1-62 | MNRFPWDEAMRFGLGVLRLPPREFWGMTPRELAAAFEALNGKRAVPPGRDALDELMRRFPDG |
| A0A7W6CNY7 | 8-73 | GATPFPWARVLHVGLCLLRLPPQSFWAMTPVEFHAAAGGLSPPRAPVSRADLDGLMARFPDSRATS |
| A0A5C4XQE1 | 55-117 | None |
| A0A1Q8ZYB0 | 1-70 | None |
| A0A7T7HP00 | 30-99 | None |
| A0A1S7SQU8 | 13-73 | None |
| A0A4Q3CEE2 | 13-72 | None |
| A0A2U2DXX9 | 148-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.