DPCstruct | MC5099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Standard deviation of domain lengths | 8.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165LB83 | 42-123 | LYGPRSFAEMTQDERMRACYFHAVLKFLSGDKMKNASLCSRLGIATKNAAQATAVINRALDAGLIRVADPDHPRAGYVPHWA |
| A0A4Q9HHQ5 | 10-85 | MSLQERIEACYQHSVVQYYGNEGMTNASLRQRFGMHDKQASQISRLIREAIDAGRIKSKDPDNESRKFTIYWPYWA |
| A0A1I7JCH1 | 319-402 | None |
| A0A6P0MM66 | 1-76 | None |
| A0A2N5NX45 | 6-67 | None |
| A0A133YDQ7 | 2-60 | None |
| A0A2T5R551 | 55-127 | None |
| A0A7W5IPE9 | 43-125 | None |
| A0A1M3P1L8 | 14-98 | None |
| A0A328YHA6 | 84-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.