DPCstruct | MC50981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 126 ± 22 aa |
| Standard deviation of domain lengths | 22.25 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 68.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 36.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316SVI1 | 24-135 | RRLFLLWIILACIGTGEGKNPFARYGYPVKVATMSNGKYEEFHDTERYVVIGSVLFDTETQTVAGRAGTDTCAPPPRAICRYISIDP… |
| A0A401U4J0 | 1-141 | MKTIAFLICLFFQISTICAQQPFEKYGYKVKVATLSNGKFVETFDQDTLAQIGSVVINRRTGKIVSFVTYDTTYSEATLQPELISRW… |
| A0A4S4A342 | 18-144 | None |
| A0A327W660 | 19-127 | None |
| A0A7Z6S1U7 | 36-145 | None |
| A0A2P8D0X7 | 13-124 | None |
| I4AKX9 | 29-152 | None |
| A0A3N7CTU5 | 74-174 | None |
| A0A086FBC0 | 75-175 | None |
| A0A504JKN4 | 15-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.