DPCstruct | MC5098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 196 ± 16 aa |
| Standard deviation of domain lengths | 16.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q9H4J0 | 1-186 | MKDANSLKISNQIGPIAQGTGFLPFGPVAARGSYLKIEFEGIAGVKAREISLKLVWLNLPTNFGVYFQGYQPKNAISNHSFYVDFYW… |
| A0A3S0QSY6 | 87-277 | VKGVKSVQIENDNGALNSEKPYYPFTAQPVTGSNFYIRCPEMFSKKWKKADITINWKNAPDSIKELYDGYVISPNQNISLKEFEAAE… |
| A0A539DWD8 | 1-209 | None |
| A0A090T4H5 | 122-318 | None |
| A0A6G3Z529 | 1-226 | None |
| A0A845W801 | 1-221 | None |
| A0A4R6N980 | 579-780 | None |
| A0A2N1ZY72 | 134-287 | None |
| A0A1C7PC93 | 467-669 | None |
| A0A0Q4KQT6 | 315-520 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.