DPCstruct | MC50976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 2.50 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 82.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 63.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2BXW8 | 1-66 | MSQRREISEDGRELLFDHGAPYFTVTNPDVLRVVTEWESRGLVAEWKSNFGSFDCFTNKIVNTEHQ |
| A0A6A3AU53 | 96-159 | MSQRREISEDGKELLFDHGAPYFTVTNPDVLSVVAEWESRGLVAEWKSNFGSFDCSTNKFVNTE |
| A0A4V4H6T8 | 45-111 | None |
| A0A6J0N3V2 | 115-181 | None |
| A0A6J0JQ50 | 1-69 | None |
| A0A287SIN9 | 6-71 | None |
| A0A287SIJ1 | 33-92 | None |
| A0A5D2HYB2 | 43-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.