DPCstruct | MC5097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 162 ± 26 aa |
| Standard deviation of domain lengths | 25.52 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833GUK6 | 12-172 | RLLVCHGYGCQAQDEVRYSEGQLGEIRRLLFAADDAGGEREHLAVALGTLYGWAGQQSDIRNDKGGNFADEGVPGRMDCIDHSTTTT… |
| A0A537XRV3 | 21-180 | KMTVCYGFVCRRREILDFTAADRAALTKILGSGRASAAAERAAVQKAVIWFDRRMGPVIGTAKRVAKADFRYFDAPHNYDCWDTTRN… |
| A0A1G0JL44 | 2-115 | None |
| A0A2N6D0A6 | 32-200 | None |
| A0A369CET6 | 39-218 | None |
| A0A3A0EWQ9 | 27-195 | None |
| A0A0P6W7G8 | 93-268 | None |
| A0A0F7K476 | 2-149 | None |
| A0A248UEU1 | 6-128 | None |
| A0A1T4WLX7 | 25-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.