DPCstruct | MC50964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 228 ± 43 aa |
| Standard deviation of domain lengths | 42.82 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K6WBL4 | 11-265 | ALARVPPEQRQHWSSVAAIQAGYLVSVSSLITGAQLALGLPLTYVVLAGVLGYAVIVALAIPQGIQGRDLGVPSVEVATSAFGEQGS… |
| A0A3E0FHB3 | 8-185 | DPLIENHTVDYVPLAERHGKARDLFTLWFSTNIAPLPIVTGAMVVQVFHLNLFWGLLAIALGHMVGGVVIALASAQGPCMGIPQMVQ… |
| A0A0B8NQA5 | 1-170 | None |
| A0A438NFR7 | 453-729 | None |
| S7W360 | 755-1048 | None |
| S3BUA0 | 25-224 | None |
| A0A420TQP6 | 60-315 | None |
| A0A535QGP7 | 26-246 | None |
| A0A166Y156 | 44-309 | None |
| A0A820RFN0 | 96-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.