DPCstruct | MC50962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 144 ± 26 aa |
| Standard deviation of domain lengths | 26.09 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1J171 | 1-119 | MAANVETMFYTREKPWHGLGIRVAEALTSKEALTKAGLDWHVVQKPLTTYDGSPVPGYFANIRDKDDKLLGVVTDRYTVIQNEDAFA… |
| A0A6P2RW93 | 3-158 | LVQTMAYVGADPWHGLGNKLAPKQPLEVWARAAGMDWRIEEAEVRFVAAGNRSLGSIHAFPEQKVLYRSDTKVPLSVVSSRYQVVQP… |
| A0A455ZC68 | 1-166 | None |
| A0A3S0EAH8 | 5-133 | None |
| A0A3M1UE66 | 11-165 | None |
| A0A0F9ULT3 | 75-268 | None |
| A0A3G7UCI1 | 1-104 | None |
| A0A7X3WJV5 | 46-244 | None |
| A0A3L7U9J2 | 55-194 | None |
| A0A6P2L8Z3 | 20-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.