DPCstruct | MC50953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 242 |
|---|---|
| Mean domain length (aa) | 121 ± 20 aa |
| Standard deviation of domain lengths | 20.30 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.19 |
| Pfam Score | 99.01 |
| Assigned Pfam label(s) | CL0031- CL0264- CL0221- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U9G5Z2 | 1-126 | MEGGWNEGGKGISIADVMTAGAHGVPREVTEGVIDGLNYPNHEAIDFYHRYKTDIQLFAEMGFKCFRTSIAWTRIFPQGDEQEPNEE… |
| A0A6J1CDX2 | 35-150 | QNEEEEVQRSEFPRDFFFGTSTSSYQIEGAFLEDGKGISNWDVFTHIPGKIKNNDTGDVADDHYHRFLEDIELMHSMGMNAYRFSIS… |
| A0A5P1FBU1 | 19-117 | None |
| A0A2C9KAN6 | 222-322 | None |
| D7KXA8 | 3-121 | None |
| A0A446NCQ0 | 23-123 | None |
| A0A6A3B358 | 8-121 | None |
| A0A3Q4MV15 | 485-606 | None |
| A0A4U6TR46 | 11-146 | None |
| A0A2E3AHE7 | 30-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.