DPCstruct | MC50951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 140 ± 7 aa |
| Standard deviation of domain lengths | 7.35 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 70.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1C0A9 | 2-142 | ALKANCPDDGPGTLNVVMSRRPLFFMETNPQPRKHTLWQATADFTDGKVSMHRQHFLQCPQRLLNKHFEKLVQCDSHLNFLSQQPEI… |
| A0A059B4H7 | 3-122 | IQWSDISAIRASIEENKPGILEIELHQPPTFYKESDLQPRHHSNWISADDFTGGQALMRHYLEFPSAALDKGYVKLLNTDRRLLKLS… |
| A0A397ZM45 | 64-204 | None |
| A0A2U1QII7 | 226-358 | None |
| A0A368PZV0 | 89-221 | None |
| A0A6A3AMW2 | 89-234 | None |
| A0A7J7D6V6 | 527-672 | None |
| A0A6P5F2Z7 | 172-321 | None |
| A0A2G2V5S6 | 184-321 | None |
| A0A5P1EGL1 | 760-902 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.