DPCstruct | MC5095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Standard deviation of domain lengths | 8.60 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 23.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8GV55 | 2-86 | FYLPEQYPLLLETVDDIELFDEKWEEWYQKHIQFKTELKKNTGIQIHEIVVDVNELNEYCVMNALKNTEATRMLFVNYLANLNKG |
| A0A833GP69 | 83-173 | QSLVIGVTWYTPETWAQVKATAVDPECFEETFEKWKAMAVAARRNFQRSGVMALECQIVPEAFFVWCAQHDKQNDSTARGEYVSEKL… |
| A0A2A4I195 | 41-144 | None |
| A0A7G6T2K4 | 15-117 | None |
| A0A2W7C509 | 261-350 | None |
| A0A5C8J2A4 | 1-92 | None |
| A0A142XSR3 | 142-234 | None |
| A0A525IG42 | 39-134 | None |
| A0A0J6S706 | 2-87 | None |
| A0A848LEX6 | 253-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.