DPCstruct | MC50949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 538 |
|---|---|
| Mean domain length (aa) | 226 ± 50 aa |
| Standard deviation of domain lengths | 50.35 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 13.04 |
| Pfam Score | 97.35 |
| Assigned Pfam label(s) | CL0094- CL0015- CL0240- CL0523- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A658Y700 | 21-255 | IAAALPQDEKLITGQLDNDLRYMIYPHAHPKDQVNLWLQIHTGSLQEEDNERGVAHFVEHMMFNGTKTWPGNKVIETFESMGLRFGR… |
| A0A535EWJ2 | 29-243 | DRAGEMVGARTRLLAAQNGSGYTPAPSPLLKPGIAFLNKKTEQAHICLGTRAISYLDDDRYALDLINTILGEGMSSRLFLEIREKRG… |
| S0F6G1 | 27-220 | None |
| A0A7S0LYJ5 | 38-239 | None |
| F4Q925 | 575-864 | None |
| A0A401FNG7 | 72-288 | None |
| L5KC83 | 12-218 | None |
| A0A7C4T888 | 263-485 | None |
| A0A820DLA9 | 31-231 | None |
| A0A0D8XHG5 | 219-440 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.