DPCstruct | MC50948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 185 ± 24 aa |
| Standard deviation of domain lengths | 24.08 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535EV26 | 1-192 | MNPIQRAYPERYPEQEHEHFLEGEGFLEAAMSPSQRVYVESLMEHLGHAAAEAETEAEAEQFLPLLMPLATSILPKLLPSIGKVAPK… |
| A0A4R8IVB7 | 185-347 | PTQAFAEYLAAKAATSESQSEAEAFAGSAVTMSLSTRDRQRLEVMLPHLVRGTAVLTRLLHRNPRTRQAVRLVPGIVASTGRTLAQH… |
| A0A563EW02 | 54-206 | None |
| A0A352APL4 | 119-278 | None |
| A0A535N217 | 1-228 | None |
| A0A1E4L0D7 | 7-224 | None |
| A0A7C5TR95 | 82-257 | None |
| A0A502GHJ8 | 109-297 | None |
| A0A1E4L0D8 | 45-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.