DPCstruct | MC50945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 603 |
|---|---|
| Mean domain length (aa) | 267 ± 53 aa |
| Standard deviation of domain lengths | 53.44 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 18.51 |
| Pfam Score | 98.69 |
| Assigned Pfam label(s) | CL0745- CL0125- CL0167- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535EJJ6 | 18-263 | WTSTTDKPLFGPDGKPVVSDVNQGNEGDCWFLSGLGAVAMKNPQLIQQNIHQNDNGTYTVTFYQDGKPVQVTVTDSVPGGNQYGDYA… |
| Q07SP7 | 271-527 | FKVSYSTSSNSLVAPDGYGMDDVNQGYLGNCYFLAPLAEVADQNPDLISSMFTSNGNGTYGVRLFVNGVAQYVTVNSSLANGGSLFN… |
| A0A0V0QX53 | 95-393 | None |
| A0A7S0MAI7 | 269-572 | None |
| A0A516N372 | 34-218 | None |
| A0A1H9HWD1 | 278-569 | None |
| A0A0N1PF13 | 213-482 | None |
| A0A397FFE6 | 8-209 | None |
| A0A834XP12 | 142-389 | None |
| A0A7R9KGZ3 | 54-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.