DPCstruct | MC50944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 83 ± 9 aa |
| Standard deviation of domain lengths | 9.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06353 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535E8G0 | 2-92 | KRCPRCGCQRRFRCTGKFRVNANRKLVDIWLLFDCCTCGTIAKLPVLERVPASRVGPSRLRAFYDNDPDRARTARRDVALLRRGGFT… |
| A0A6N7SQM9 | 10-94 | HHCGGCKKTQEFINSGKFRVNANGNKVDVWLIYRCKKCKHTWNLTIYERIKASKITPAEYTLFMENDFSLAARYGKDINFLTRNK |
| A0A1M7Y7V3 | 16-98 | None |
| A0A521JI20 | 35-129 | None |
| A0A2Z5JLL8 | 12-99 | None |
| A0A355TW38 | 1-67 | None |
| A0A2V3YET3 | 25-108 | None |
| A0A7W6U606 | 5-82 | None |
| A0A7C2NBN2 | 15-91 | None |
| A0A845J4M5 | 13-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.