DPCstruct | MC5094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 4.70 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P8IIA4 | 7-83 | MRARVVYDYPRDELIGTLLATGETFVTSDPKQMAELLFAAGVRHGQVQMPDWREGDIAPATGDKIALNFRLVQLGRQ |
| A0A833GMP5 | 5-80 | ASIILFKNEFIATLSDGCRIQKPELRELANALIHAGVHLNDVQFEWNGSSGQRMITAGQQVAFRAEMRRLERHQVK |
| A0A103R5W5 | 2-67 | None |
| A0A2N7WKH2 | 3-83 | None |
| A0A6I6GKH0 | 6-86 | None |
| A0A522MJV5 | 2-78 | None |
| A0A2V4TW75 | 68-147 | None |
| A0A2G3J8B4 | 62-140 | None |
| A0A4R6GHZ5 | 1-81 | None |
| A0A849HPA8 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.