DPCstruct | MC50935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 5.79 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 48.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5WS37 | 1-71 | MVGIGGALPTSDTDIRLGDVVVSTPPGTVGGVVQYDLGKRLQNARFERTGQLNAPPQMLLGRAREMRWRYN |
| A0A1V6QDG9 | 65-135 | MVGVGGGIPSAAHDIRLRDVVISFPKGTSGGVLQYDIGKVGTKGEFHRTGSLNSPPKALLTASNLMRAAEL |
| A0A7C8NKB1 | 94-160 | None |
| A0A5M3YYI3 | 88-159 | None |
| A0A0B4HN35 | 292-369 | None |
| A0A0D2GMH3 | 64-134 | None |
| A0A428PZS2 | 274-346 | None |
| A0A4Q4UMW2 | 26-116 | None |
| G9NLU6 | 60-126 | None |
| A0A094D9B7 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.