DPCstruct | MC50934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 350 ± 53 aa |
| Standard deviation of domain lengths | 52.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 23.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5WMT9 | 20-304 | PKAPCLQLEVELCPLLKYTLCRPAQDDDPRPFVFRWSPFNEGYSQDGFVLLRHTSDGKLEKVPVPDAIQDPVDIVNPGGSIVYCGSL… |
| A0A366S9L3 | 36-400 | TQAMAELQIYINITSRYRVFDKTGKLPYSIAFGLCRRSSNDENPRSLRLTAKNSILDVPYALSHGLLSLRENEKEIDTGHLRSSDGN… |
| A0A420Y1S1 | 2-339 | None |
| A0A1V6T9P0 | 229-573 | None |
| A0A177DB71 | 4-365 | None |
| A0A3D8RQT0 | 242-619 | None |
| A0A0S7DTK4 | 2-226 | None |
| A0A0S7DNX2 | 444-842 | None |
| A0A094EVY9 | 20-412 | None |
| A0A6A6AFW2 | 1-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.