DPCstruct | MC50930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 96 ± 11 aa |
| Standard deviation of domain lengths | 10.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553KRJ3 | 14-102 | RKHLALAFDIAVQNGGIKNSAAKEIERQIRGKKLSHIEKMRIIAKEVADASNPRWRDDVLSRKMTIVIGGGTVHGKKYDLAKQYGLS… |
| A0A1E4LAC0 | 88-185 | SERGVALMFDILTQNGSISASTKAQIFADYGRIPATASEKEKEVARLRAVATRRAQSALPEWVHDVLVRKLTVAEGEGTVHGERYRL… |
| A0A3M0XXM5 | 258-368 | None |
| A0A1A5WZ26 | 1-82 | None |
| R4K021 | 987-1075 | None |
| A0A511N743 | 138-231 | None |
| A0A2V7S3T8 | 424-540 | None |
| A0A7V3UNB6 | 404-500 | None |
| A0A5J4DST0 | 220-310 | None |
| A0A1G0AQR1 | 127-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.