DPCstruct | MC50921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 244 ± 26 aa |
| Standard deviation of domain lengths | 26.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7QRL0 | 1-225 | MMEQVQLALDPCGATCSSCYTHCLLPRGHSSSIKHDCLRSSHQCTHSCLYCATGGVDSAALCKSLAGHPGPHSCGNAGHECGERCSL… |
| A0A0C3AHJ9 | 62-276 | LCGLSCSSCGLLCLDQKHHSGKHDCKTSHCCPTLCTFELQHTEDTVPSCDMPAGHAGRHVCKILPHLCGAPCDLSGRNGCMLSCTKP… |
| W2PG38 | 499-779 | None |
| W2Y2S5 | 200-470 | None |
| A0A0D0DC41 | 329-576 | None |
| A0A6G0S2C6 | 325-557 | None |
| A0A0G4G8U6 | 131-363 | None |
| A0A067CRK7 | 619-850 | None |
| A0A2N1MEW9 | 212-463 | None |
| A0A6G0WNS5 | 703-922 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.