DPCstruct | MC5092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 5.53 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0J5Z6 | 186-269 | PGIYGYYIDLDERGDFQADVRDVNGKTIFEIRAGESLGEDESSIFDDGYMRNKDDLSGLTEYMIGLGIIAEGSDVLPMSEFEAR |
| A0A7L6A7M9 | 2-90 | SAFKPIRQELALVIDLDERGWFKAHVENQNGKTVFQFSNEDEETGWPSEDGLWLVEDGFMRHGRDTDGLLMYLKSIGIAKPTATMAL… |
| A0A1B8TBR9 | 36-103 | None |
| A0A7Y8D5U3 | 29-109 | None |
| A0A6L5Z6Y3 | 1-82 | None |
| A0A5N7WA63 | 424-508 | None |
| A0A060UVS3 | 181-259 | None |
| A0A7Z1ZBV4 | 1-74 | None |
| B7J8W4 | 84-160 | None |
| A0A6S6Y9D3 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.