DPCstruct | MC50919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 318 ± 66 aa |
| Standard deviation of domain lengths | 66.00 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7QKC7 | 90-430 | LRDATTSLGADCSWCLERGELVSVYKRAKQVCSSGSCRSRLSELCTRQLPCGHFCCGVRGTSPCLPCFQEGCNSQARLEGDGNCCFC… |
| F0ZZF3 | 1-245 | MCMICWTEGLTEAPSIQLDCGHIFHQDCTKNLLEARWSGSRISFGFAQCPICKIPISHKSLKPITDVIDNIREEIIRKGKVRVEYHN… |
| A0A5J4Z0Y6 | 14-282 | None |
| A0A7S4P652 | 334-578 | None |
| A0A0D8XSF4 | 588-956 | None |
| D3AZM8 | 326-613 | None |
| F4PV64 | 718-1107 | None |
| A0A4W4FJ93 | 147-491 | None |
| A0A0D2MR88 | 355-592 | None |
| A0A6A4V807 | 378-693 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.