DPCstruct | MC50918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Standard deviation of domain lengths | 10.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7QD76 | 16-82 | ISIYGTKSRLYVVGHDEQLGICRILKFRRQDGPRLDVVEDPLVYSPEQCTLVLRRVHEQSGGLQLIS |
| A0A7J8QAS2 | 1-70 | MIGRDKNQTVWRVLKIHRLDSSELTILEDPTTYSEFECFDLLRRIHDGNRSTGGLNFVTACYGIVGFVKF |
| A0A6V7UMI8 | 5-91 | None |
| A0A433QKZ4 | 30-130 | None |
| A0A833XHE8 | 15-98 | None |
| A0A5J5AUY4 | 19-111 | None |
| A0A507FM44 | 283-382 | None |
| A0A7R9Y2E5 | 27-111 | None |
| A0A1Y3BMH4 | 1-85 | None |
| A0A444CBF9 | 20-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.