DPCstruct | MC50916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 95 ± 6 aa |
| Standard deviation of domain lengths | 6.31 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.60 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | CL0602- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I2V268 | 87-180 | SEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGL… |
| A0A402FY62 | 41-133 | CDCLHGGTCISYHLFSQVRRCLCPQGYSGDHCEIDAKSQCYMDSGEDYRGTKSVSELNEQCLAWNSPLLKRWPYNDGMENAMLLGLG… |
| A0A0G2K1V0 | 91-184 | None |
| A0A821JYD3 | 94-185 | None |
| A0A667Z3A5 | 26-112 | None |
| A0A6I9NSE4 | 28-124 | None |
| A0A2U9BUV2 | 82-178 | None |
| A0A0P7UNC4 | 21-131 | None |
| A0A061IAT5 | 142-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.