DPCstruct | MC50909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 262 |
|---|---|
| Mean domain length (aa) | 166 ± 26 aa |
| Standard deviation of domain lengths | 25.89 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 17.51 |
| Pfam Score | 97.34 |
| Assigned Pfam label(s) | CL0023- PF04043- PF03140- CL0268- PF04045 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445EPA2 | 16-188 | LFVSSFSATAQDLLRSSCSHARYPALCIKTLSPYATGSATPMDLAQAAVRVSLARSRSLSTYVTTLQSQMQQQAPPSTDRAALKDCV… |
| M1BJQ8 | 4-102 | AHDLVNTLFKQATDPKLKTRYSSCLENYNDGIDDLRGLPALLKSRDYSGLNIHASAALDDPSTCDDNFSDPPAEAPQLKVASEKVQG… |
| A0A7N0UCQ1 | 10-160 | None |
| A0A7N0U7Y6 | 20-195 | None |
| A0A445D9Q5 | 9-142 | None |
| A0A803PW50 | 16-191 | None |
| A0A0D9VGQ5 | 182-406 | None |
| A0A5E4F167 | 22-179 | None |
| A0A164W0G6 | 18-224 | None |
| I1I0W3 | 14-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.