DPCstruct | MC50908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 174 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.01 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0673- PF13966 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445EM86 | 1-179 | MLDWKKLRDIRELRWELALRVLVLTPSQVGSSSLVEDIHTNINYDAGEIVTPTPGVKRIFSSPCCLPHIAQAILSGEPSIVEAAAAL… |
| A0A2R7VQB7 | 21-196 | MANWTAIQNIPQLKWSLLARGTSLMNDSELAILILNMLITMIEYYPSKNEEGAIIWPICKIRLVLSGSQCLPHIVQLLLTFDPTIVE… |
| A0A182EI93 | 743-919 | None |
| A0A3Q0JLE1 | 528-698 | None |
| A1Z7S0 | 1014-1190 | None |
| A0A445EMA4 | 103-282 | None |
| A0A368FDJ1 | 484-661 | None |
| A0A077ZJH8 | 356-530 | None |
| A0A0E0F153 | 814-972 | None |
| A0A452YQH6 | 7-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.