DPCstruct | MC50907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 143 |
|---|---|
| Mean domain length (aa) | 241 ± 50 aa |
| Standard deviation of domain lengths | 50.19 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445ELZ1 | 421-665 | RKIIDLEQGWDFMQKGITKLKNILEGLPEPHFSSEDYIMLYTTIYTMCTQKPPHNYSQQLYDKYKEVFEEYIQSTVLPSLREKHDEF… |
| A0A6H5JWK1 | 1-181 | MESLVGQTPDCNAFLQLVDRKWQDHCSSMLTLRNVFLYLDRSFVLQAPNLRSIWDMGLEHFRNHFQALEEVEAKTVAGILTLIERER… |
| A0A090LDD9 | 22-276 | None |
| R7QH70 | 1-223 | None |
| A0A817R7W6 | 10-273 | None |
| V5D441 | 19-340 | None |
| A0A835H2M0 | 76-244 | None |
| A0A445C3S8 | 122-474 | None |
| A0A0C2J355 | 27-333 | None |
| B0E692 | 6-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.