DPCstruct | MC50901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 75 ± 6 aa |
| Standard deviation of domain lengths | 5.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 34.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09932 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A355BLH7 | 1-64 | MIKAIQKFFMEERDEEINEFQASIVLYFIFEKIGPYIYNRAIEDAYLFMTGRIEDLYALQKRDR |
| A0A1T2XD72 | 1-81 | MIPMKLPKEQKEMIIRNVQMYFENERDETIGDLAAEGFIDFMIKELGPHLYNKGIADARTVLIQKTTQLEDELYSLEKRIK |
| A0A843TBZ0 | 32-109 | None |
| A0A0N0E9V4 | 1-77 | None |
| A0A7Y5RG72 | 68-140 | None |
| A0A498TTL1 | 29-97 | None |
| A0A826H1K3 | 1-84 | None |
| A0A1C3SEA4 | 27-105 | None |
| A0A285SDJ2 | 4-80 | None |
| A0A2N2EFD5 | 7-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.