DPCstruct | MC509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 7.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453E517 | 22-95 | LCDGDAVRPEDAREIALLHTRTGRRVRIRLPGLRGYRIVGFSDGLLVLLRKSTTALRVLHPLTLVAVDFPSLAT |
| A0A0D3FTP3 | 4-84 | KAHHNKGTTAAATHRRHRFLNISTGGCIHTDDIPELADHTMLALTPEGLLLLLHEPSLRLHLLNPLTRHRTDFPPVTALLT |
| A0A453HTQ7 | 37-99 | None |
| A0A811MVH4 | 1-91 | None |
| A0A368Q758 | 110-178 | None |
| A0A1E5UJ50 | 1-74 | None |
| A0A0D9X0L8 | 1-78 | None |
| A0A835F8S6 | 17-84 | None |
| A0A3L6RM07 | 4-82 | None |
| A0A835FGL5 | 740-814 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.