DPCstruct | MC50895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 282 ± 14 aa |
| Standard deviation of domain lengths | 13.75 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 65.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 45.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05461 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8WRR7 | 983-1257 | AWWDTVEKWDEVPSDEEDNKDEDEYKSFSILSDKVERGLRLFNQVFTERAEFLWLAIIRLHAIADDISEYHEKAKKVVISGGSTSAV… |
| A0A3P9JR41 | 1-261 | ETDEQHDLFVSYHSARSFEEKATNLRKARRLYNLLMMKRKESLEKGIKSFQAICAQLEKMKKTNKAMGIAGGTTGAVGGVAAVVGIA… |
| A0A673Y9S8 | 401-691 | None |
| A0A060WTP5 | 1-277 | None |
| A0A060WQQ1 | 122-418 | None |
| A0A4W6BS31 | 105-398 | None |
| A0A671RLY3 | 159-453 | None |
| A0A672GWT3 | 865-1119 | None |
| A0A3B3TQ71 | 40-333 | None |
| A0A3Q3AEQ6 | 992-1266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.