DPCstruct | MC50891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 295 ± 48 aa |
| Standard deviation of domain lengths | 47.78 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.33 |
| Pfam Score | 85.56 |
| Assigned Pfam label(s) | PF08354- CL0198- PF17951 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G1I743 | 1-325 | MPIDGILVGTAAMATLESTTSPSVKRMLVETQGTGEWISAGKARGGMASSRSQLGADIHEIDNSASRCGQLLDEVAGDADAVAERRD… |
| A0A0J8S2A9 | 813-1091 | MPFDGCMFGSRMMTAKEAHTSKAAKEAIAAAPGVDDSEWEKTYNGPAGGVITVRSEMGEPIHKLATRGVLLWAEMDKRIFALDKAKR… |
| A0A109FHW6 | 755-1121 | None |
| A0A317SZM6 | 351-635 | None |
| A0A401H1S2 | 1-358 | None |
| B8NVJ6 | 299-633 | None |
| A0A1U8QKU6 | 185-433 | None |
| X8AZ64 | 1-304 | None |
| A0A2S8BGH0 | 154-467 | None |
| A0A2G5BAH8 | 779-1088 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.