DPCstruct | MC50889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 107 ± 19 aa |
| Standard deviation of domain lengths | 18.68 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19291 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3Y0U5 | 7-122 | PHVLREYALLADGERGIVIGPRGDCCWMCLPRWDSPAVFGSLLGGNGVYAVSPDHPRFVWGGRYELGSLIWRSRWVTTDGIVECREA… |
| C7M368 | 253-373 | ALPLEQYGFVGDLHTGAMIGAEGSVAWLCVPRFDADACFASLLGDESNGTFRIAPSGPFESTQTYVEDTLVLETTFATRTGRAKVID… |
| A0A2A2K6Z5 | 398-539 | None |
| A0A251XRH8 | 17-105 | None |
| A0A3M1D9K9 | 1-104 | None |
| A0A511D036 | 5-89 | None |
| A0A2P6NRF1 | 423-533 | None |
| A0A286I4T9 | 3-83 | None |
| A0A7W5HES6 | 1-122 | None |
| A0A5C3M0F5 | 214-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.