DPCstruct | MC50883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 137 ± 21 aa |
| Standard deviation of domain lengths | 21.24 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 93.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3XEH2 | 30-162 | PWPEDPVAALWHATTLLREHRGDGHVAVLVAAGISGRESNVLHCAADAVPRDYIMQTRHYDDAEWRACQQSLVDRGLLDEDGSPTPA… |
| A0A238YRN4 | 105-262 | APLLQEVVMAADASGRPLFAANRDLPVPEDPVEALWQATTSLREHRGDGHVALLTAEGLSGLEANVLACAMGIVPPERLQESRGWSP… |
| A0A6B2DMN6 | 2-113 | None |
| A0A7J9YLZ8 | 91-223 | None |
| A0A2H1K4L2 | 118-290 | None |
| A0A6L6EL12 | 2-133 | None |
| A0A4D4K2U5 | 26-140 | None |
| A0A7Y3BVA3 | 2-115 | None |
| A0A7V9SMU7 | 1-133 | None |
| A0A3B9QHH9 | 6-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.