DPCstruct | MC50880
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 111 ± 10 aa |
| Standard deviation of domain lengths | 9.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03676 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7XWN8 | 1-111 | MTLFNGLSPAKMKTPEIPQVVYCGNPRIVLAENINSEDGRLIGLKIKFKIEEVTDHSVDELQLVEFERPIFFNDTQEAVMTKLGAPS… |
| A0A6I9NUG4 | 13-111 | MVKRMHIYTGNNLQETRAPAMPLACFLGNIFAECVNVLRDRAGALGLKLRLLTAGCGPGGMADSKVRSIERRIYFGDSCQDVLGALG… |
| A0A2A2K166 | 1022-1124 | None |
| A0A7J6ZE63 | 689-791 | None |
| A0A1A9VYL3 | 187-287 | None |
| A0A3P8KET8 | 14-108 | None |
| A0A455ABE6 | 163-273 | None |
| A0A0S7K2X9 | 5-117 | None |
| A0A0S7K4E1 | 79-199 | None |
| A0A1Y3ESB2 | 719-835 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.