DPCstruct | MC5088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 87 ± 12 aa |
| Standard deviation of domain lengths | 11.85 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R5FM84 | 1-79 | MITQDNFKSFLLSLGFEQNGDVLSKHFLHTEGMLKVDFNKKQLIYPEDHGLIINERQTCNFSQNENFVVFECVHRLLLI |
| H5VCZ4 | 1-113 | MITKDNLKEVLQALNFAQEGNTYTRAYKNGATISVDFTTQSITYTPQDKRFKEGDYPSLENPSKGFVIHRSTTTNFSSNENFVCLVA… |
| A0A413HD84 | 1-97 | None |
| R9IRS5 | 1-80 | None |
| A0A7X8J541 | 1-92 | None |
| A0A7X5YCW7 | 1-79 | None |
| A0A1W1BIG7 | 1-79 | None |
| A0A6L5XBG8 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.