DPCstruct | MC50877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 188 ± 26 aa |
| Standard deviation of domain lengths | 25.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7XU40 | 36-226 | IISSSTNTASASLIRQCSCTEESICINSFKNQVHDCFNTCWTQDVQIKALSANPEHLKKCFTNKTLLDKFINCLKKTHQTCVSVKNG… |
| A0A0N4Y6H1 | 86-283 | MLYLILLVAIVGQVHSQMIRQCSCQEFEPCKRGASGNIMQCADQCQSHIAALGASYPAMRGCLQSKEGILNAAIQCQAGQLAGACSR… |
| A0A0M3HQA4 | 128-304 | None |
| A0A2A6C104 | 18-202 | None |
| A0A2A6CT10 | 194-379 | None |
| A0A811L7D7 | 11-245 | None |
| Q09403 | 16-193 | None |
| D3YT45 | 2-174 | None |
| A0A3P7ECC7 | 2-158 | None |
| A0A4X3PHP4 | 222-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.