DPCstruct | MC50876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 174 ± 25 aa |
| Standard deviation of domain lengths | 25.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21738 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6JST0 | 402-646 | YVLHTMFSSVEIYLNNKLITPVSNTAAYRAYIEMLLNYSTDVKQSQMSAKLVEMDTHNAFDTCGDANTGYKKRRAYFSESKEVDAVG… |
| A0A6V7XTQ8 | 21-204 | ERRRLFENSKTAQFIAKLDADIFNQPLYLINHCEVDIEIIPNDSRFVLMTFGLQNAMEVATRYHFEVVNMKLYVKKVDLMDGLALDI… |
| A0A4Y2PBI8 | 40-212 | None |
| A0A6A4UK62 | 80-242 | None |
| A0A6P8I9T1 | 104-310 | None |
| A0A6S7HN63 | 28-194 | None |
| A0A4Y2TJC5 | 19-208 | None |
| A0A7D9LM41 | 7-181 | None |
| A0A6V7XI05 | 166-369 | None |
| E2BR88 | 66-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.