DPCstruct | MC50875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 244 ± 40 aa |
| Standard deviation of domain lengths | 39.50 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 65.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7XTP4 | 17-257 | SVIPDGSKNDNMQHQSKHIHDRHRLHHGLTAQPFEEEPLKAHRFRQYVSYLKRGIPFIQPPEMTLLQWESEKADFEEALPSELRALL… |
| A0A4S8UL50 | 109-325 | PYAEDEAKRARYRIFLESCSGQRDALPERVKGSTIDEWTKEMREFAQAAEVFRPISGLMASRFTSSSSSPRLATDTMPSASEKPSRP… |
| A0A1X2GBA7 | 330-589 | None |
| A0A0D0YB03 | 468-715 | None |
| A0A0D0CJJ0 | 52-248 | None |
| A0A7R9JMG2 | 56-265 | None |
| H1VW14 | 2-199 | None |
| A0A673MJF0 | 364-686 | None |
| A0A0F4Z8Y2 | 316-616 | None |
| A0A060T4L3 | 258-538 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.