DPCstruct | MC50873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 251 ± 22 aa |
| Standard deviation of domain lengths | 21.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7XPU4 | 1-228 | MTIGGAPSIRKYAVLNDRRQIVSKDSNGNLELWDALQAKKLKNLPQGTSIEDVIRENVRKSWIPSWFSVETKCGVLEITLDESDVFS… |
| A0A3B5LXM4 | 180-437 | YDNDCTTPLTPLCTQPEQVIKGGASIIQCHILNDKRHILTKDTNNNVAYWDVLKACKGEDLGKVEFDEEIKKRFKMVYVPNWFSVDL… |
| A0A0C3TEY2 | 289-523 | None |
| A0A445BK12 | 158-407 | None |
| A0A2K3NPK6 | 89-314 | None |
| A0A5J5T780 | 683-972 | None |
| A0A6S7LE66 | 1-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.