DPCstruct | MC50872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 55.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03299 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7XNC1 | 1-83 | MLAISRQTLSELMELLRQDRSPVCQGTACRPVLEHSIQQHLTHFSMVTHGFGTPAILAALTAVMSWLNESEKNLLQQQSTEAK |
| A0A7F8QKB2 | 12-93 | MILATKQICKEFQDLLSQDRSPLGSSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNYLEKHTTHKNG |
| A0A2J7PPF9 | 107-185 | None |
| A0A6A5ERQ1 | 2-80 | None |
| A0A1A6HXI9 | 249-338 | None |
| A0A4Z2BL83 | 58-141 | None |
| A0A803WFJ9 | 265-373 | None |
| A0A2A4J1V7 | 52-123 | None |
| A0A4S2J9I9 | 208-288 | None |
| A0A2G9UBX6 | 439-526 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.