DPCstruct | MC50869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 161 ± 31 aa |
| Standard deviation of domain lengths | 31.11 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7XHX5 | 26-168 | TNLWDTLFDLIILDAFEDLQRPPSAIAALVKNSFISKSMKESTLNNLIWSIIKVKRQRLQVKDGFISHFYDISQILTSSLAMGLFGG… |
| A0A3P8BRR6 | 95-267 | MEYLNETQHLEIIDRELKQRGVPELGFWDVVLDYILIDAFEDLSRPPSAVLAVTRNMFLNQTMKESTLVTVIWSMLKAKRARLAVAN… |
| A0A182EJD4 | 4-145 | None |
| A0A7J7ZZ42 | 59-283 | None |
| H2YG06 | 24-189 | None |
| A0A1I7VNJ7 | 286-479 | None |
| A0A5J4NMN6 | 2-135 | None |
| L9KHP3 | 675-848 | None |
| A0A0S7FJ37 | 6-104 | None |
| B2KI78 | 24-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.