DPCstruct | MC50867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 261 |
|---|---|
| Mean domain length (aa) | 144 ± 31 aa |
| Standard deviation of domain lengths | 31.49 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.14 |
| Pfam Score | 78.97 |
| Assigned Pfam label(s) | PF16488- PF16486- CL0219- PF08699- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7X9C7 | 1-151 | MHYLIDEISNILNCHTKSLRDNLNHPAKRALINSKLKGKLVRTLYADRNGFRKTFTLYGFTHKGAHSIMAYGSLARPYNVSVTAHFY… |
| A0A183BNZ9 | 142-266 | KLPLLDYLCAFNGCSLKELQVLFHSVQARHRMVAHLQQKCRLRTAHLKPPERNLWLHCHDLSAQNANRTFACSGYLELTVRQYYFAK… |
| A0A834Y487 | 481-627 | None |
| A0A834M1M2 | 114-283 | None |
| A0A7E4VSP5 | 308-430 | None |
| W9WEQ1 | 45-253 | None |
| A0A0V0QUB9 | 216-345 | None |
| A0A177T5J0 | 2-138 | None |
| A0A3Q0J604 | 188-339 | None |
| A0A553PMR8 | 63-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.