DPCstruct | MC50866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 240 ± 23 aa |
| Standard deviation of domain lengths | 22.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7F222 | 373-596 | LSFARDEIIWLLRHADNIQKKSTDDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNEMVQNLSVCPEDESIIMS… |
| A0A6V7X6V1 | 15-239 | RHYDVWQQLLLQYSPSNKKAIQKSGLQNIVVDKFLPELLYYLTEIRNLVLKNSNLISSYYIQYIAGYDAPLLTELSQRFSGGSGLSE… |
| A0A453RPX5 | 60-284 | None |
| A0A0S7F876 | 3-255 | None |
| A0A7J9DHH6 | 76-360 | None |
| A0A7S2RHL2 | 187-490 | None |
| A0A5A7PLF9 | 416-659 | None |
| A0A3P7FZJ5 | 7-214 | None |
| A0A438E335 | 5-252 | None |
| A0A3N7G1B2 | 1-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.