DPCstruct | MC50861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 88 ± 4 aa |
| Standard deviation of domain lengths | 4.43 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 20.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V1SYW6 | 10-100 | LIDHLTMHLDLDQKVFTDRLSAITEPGSTSVFTDAFDVLSSSEKEFKGFVDRQGFKLKRRRRLFDLRFNTAIANGTIAEADGKLTIE… |
| A0A4Q1FV19 | 1-88 | MKYLPFERIIYRTNLSQQEIIKRLSDFVEPKKFSFGRNYIKDYEGSVDTDSFDISRVINYRNSFLPQIYGTIQKNNDRTEIQVTMSLN |
| B4W3B6 | 1-90 | None |
| A0A6N9NL27 | 15-104 | None |
| A0A3C1RLA6 | 8-86 | None |
| A0A4V1ZDL8 | 1-93 | None |
| A0A2D8URJ8 | 1-83 | None |
| A0A5C6YDG9 | 1-91 | None |
| A0A355DXI1 | 1-90 | None |
| A0A3B0VCA3 | 7-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.