DPCstruct | MC5086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 181 ± 16 aa |
| Standard deviation of domain lengths | 16.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 69.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N4MGW0 | 21-212 | KPSPQKHRLMLSSVSWLEFIGGFAVVSLGWIAYVYRDEILRREKPPVPGTPPPPPGPKRIWQVSEESDPATQPVPAAVAGNPSYQLP… |
| A0A1S9P6N9 | 42-219 | MLQQITWTAYAATVIILTIIYYLCILPAFYREDIKRAVHKFTGRKQALAVAGDTDLLLPEGEIMGRALPEAAAIVAPEELSFAPPDE… |
| A0A1C2GMU9 | 4-160 | None |
| A0A7K1U079 | 3-195 | None |
| A0A1H7FIB1 | 10-175 | None |
| A0A4Q5TR93 | 1-181 | None |
| H1YIA5 | 1-200 | None |
| A0A1T5MA94 | 1-188 | None |
| A0A0P0NF04 | 3-156 | None |
| A0A1M7EYY9 | 23-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.