DPCstruct | MC50852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 184 ± 21 aa |
| Standard deviation of domain lengths | 20.80 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 15.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P8M020 | 4-163 | IKIEDTLYNVPESWDDVTLGQYEKWFDYVADTKMKEVELVSLISTIPFDLLSTLPLSFYTDVLNMVSFAFAGNDFKPSNKILIDNDV… |
| A0A5Q2NJK7 | 1-165 | MKASIKIPSGLNEITLGQYQKFKQTADKFEESNDFLLQKMIECFCNIELKHVLLIERKSVLEIANEINAYFSGNYELIPRFKIKDVE… |
| A0A0S8JFG0 | 1-195 | None |
| A0A2D9CKT3 | 16-166 | None |
| A0A4Q5TRD0 | 12-189 | None |
| A0A4V2FT36 | 1-198 | None |
| A0A519RNI5 | 11-208 | None |
| A0A1Z9IJL5 | 4-176 | None |
| A0A2T7BEB0 | 1-176 | None |
| A0A6H1LTT4 | 1-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.