DPCstruct | MC5085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 72 ± 5 aa |
| Standard deviation of domain lengths | 4.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A0SP61 | 42-109 | YVIPAESSPWRFTPIQMNDGSGDWWVYGQDDRNYYYFTGSGEPPYVVFPKAQATDCRGFRRDDHRTWC |
| A0A523PY26 | 3-76 | LVATENGYEIPKDSSIFTFKATKMNEGSGGWWVYGEDNKKYYALSVDPINKIICIDKGKSRKIKNFDRFEYKTW |
| A0A545TTP2 | 50-119 | None |
| A0A4R2HN20 | 2-79 | None |
| A0A379A036 | 25-88 | None |
| A0A4R7XXE7 | 172-241 | None |
| A0A1M7SGK1 | 36-107 | None |
| A0A1M5W031 | 41-107 | None |
| A0A2C8YQP2 | 102-176 | None |
| A0A6P0QMB6 | 54-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.