DPCstruct | MC50847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 126 ± 23 aa |
| Standard deviation of domain lengths | 22.73 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A413L0I9 | 28-136 | RTLLKYFLILTIGNTRPQFWTRIINGWLKKTDFNSARYAGFFAGGYYGTKELMPKKIFDKRIPMKFGKYDFWIPEEYDYYLTNLYGN… |
| A0A417UZ32 | 115-258 | GIWVDIFPYDYTSGIGKDFAKKTFKLKVLRSLVRAKCNYQTWQSGEGIILSKYIKNLPFRLAAIFLKKETLVEKYEMLCVEDENLKY… |
| A0A6L9GT41 | 51-145 | None |
| A0A7J0B7A0 | 3-113 | None |
| A0A413KI99 | 6-104 | None |
| A0A4Q7NYZ3 | 334-493 | None |
| A0A413K960 | 312-466 | None |
| A0A3C1DFV5 | 126-265 | None |
| A0A349YGJ9 | 282-396 | None |
| R5VJW5 | 6-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.