DPCstruct | MC50841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 130 ± 22 aa |
| Standard deviation of domain lengths | 22.17 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 69.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3F2S115 | 1-130 | MGSTPTKSSTEEVAVSTPRRLAHWDSKREKCANCELIYLKTLSQHLGFCSVDCKSNMTYLEKVNRTIRAMKDAVDERQQHQEQAARA… |
| A0A5D6XZ62 | 47-167 | PSPTTVAGPKARPTCSSPSRIAHWDKKREKCGNCTLIYLKTLSRHPGYCSVDCKSNAAYLDKVNRTIRAMKDAVEQQNQQQQQEVVV… |
| A0A0P1AUT1 | 53-214 | None |
| A0A662X7J5 | 1-168 | None |
| A0A1V9YID5 | 8-115 | None |
| A0A485L403 | 1-112 | None |
| A0A024TEH2 | 1-106 | None |
| A0A1V9ZRQ7 | 31-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.